Anti FAM214B pAb (ATL-HPA055751)

Atlas Antibodies

SKU:
ATL-HPA055751-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 214, member B
Gene Name: FAM214B
Alternative Gene Name: bA182N22.6, FLJ11560, KIAA1539
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036002: 91%, ENSRNOG00000009323: 91%
Entrez Gene ID: 80256
Uniprot ID: Q7L5A3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CPTKRRLLPAGEAPDVSSEEEGPAPRRRRGSLGHPTAANSSDAKATPFWSHLLPGPKEPVLDPTDCGPMGRRLKGARR
Gene Sequence CPTKRRLLPAGEAPDVSSEEEGPAPRRRRGSLGHPTAANSSDAKATPFWSHLLPGPKEPVLDPTDCGPMGRRLKGARR
Gene ID - Mouse ENSMUSG00000036002
Gene ID - Rat ENSRNOG00000009323
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM214B pAb (ATL-HPA055751)
Datasheet Anti FAM214B pAb (ATL-HPA055751) Datasheet (External Link)
Vendor Page Anti FAM214B pAb (ATL-HPA055751) at Atlas Antibodies

Documents & Links for Anti FAM214B pAb (ATL-HPA055751)
Datasheet Anti FAM214B pAb (ATL-HPA055751) Datasheet (External Link)
Vendor Page Anti FAM214B pAb (ATL-HPA055751)