Anti FAM213B pAb (ATL-HPA006403)

Atlas Antibodies

SKU: ATL-HPA006403-25

• 
• 
• 

Protein Description: family with sequence similarity 213, member B
Gene Name: FAM213B
Alternative Gene Name: C1orf93, MGC26818
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029059: 92%, ENSRNOG00000013468: 89%
Entrez Gene ID: 127281
Uniprot ID: Q8TBF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAGLLDQHGVRLVGVGPEALGLQEFLDGDYFAGELYLDESKQLYKELGFKRYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKS
• Gene Sequence: LAGLLDQHGVRLVGVGPEALGLQEFLDGDYFAGELYLDESKQLYKELGFKRYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKS
• Gene ID - Mouse: ENSMUSG00000029059
• Gene ID - Rat: ENSRNOG00000013468
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAM213B pAb (ATL-HPA006403) – 1 Found

Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51.