Anti FAM20B pAb (ATL-HPA007409)

Atlas Antibodies

SKU:
ATL-HPA007409-25
  • Immunohistochemical staining of human cerebellum shows strong granular cytoplasm positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoplasm & the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 20, member B
Gene Name: FAM20B
Alternative Gene Name: GXK1, KIAA0475
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033557: 97%, ENSRNOG00000004337: 97%
Entrez Gene ID: 9917
Uniprot ID: O75063
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DAVKKTSPYDSGPRLLDIIDTAVFDYLIGNADRHHYESFQDDEGASMLILLDNAKSFGNPSLDERSILAPLYQCCIIRVSTWNRLNYLKNGVLKSALKSAMAHDPISPVLSDPHLDAVDQRLLSVLATVKQCTDQFGMDTVLVED
Gene Sequence DAVKKTSPYDSGPRLLDIIDTAVFDYLIGNADRHHYESFQDDEGASMLILLDNAKSFGNPSLDERSILAPLYQCCIIRVSTWNRLNYLKNGVLKSALKSAMAHDPISPVLSDPHLDAVDQRLLSVLATVKQCTDQFGMDTVLVED
Gene ID - Mouse ENSMUSG00000033557
Gene ID - Rat ENSRNOG00000004337
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM20B pAb (ATL-HPA007409)
Datasheet Anti FAM20B pAb (ATL-HPA007409) Datasheet (External Link)
Vendor Page Anti FAM20B pAb (ATL-HPA007409) at Atlas Antibodies

Documents & Links for Anti FAM20B pAb (ATL-HPA007409)
Datasheet Anti FAM20B pAb (ATL-HPA007409) Datasheet (External Link)
Vendor Page Anti FAM20B pAb (ATL-HPA007409)