Anti FAM207A pAb (ATL-HPA036354 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA036354-25

• 
• 
• 

Protein Description: family with sequence similarity 207, member A
Gene Name: FAM207A
Alternative Gene Name: C21orf70, PRED56
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032977: 54%, ENSRNOG00000001225: 52%
Entrez Gene ID: 85395
Uniprot ID: Q9NSI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AFINTNIFARTKIDPSALVQKLELDVRSVTSVRRGEAGSSARSVPSIRRGAEAKTVLPKKEKMKL
• Gene Sequence: AFINTNIFARTKIDPSALVQKLELDVRSVTSVRRGEAGSSARSVPSIRRGAEAKTVLPKKEKMKL
• Gene ID - Mouse: ENSMUSG00000032977
• Gene ID - Rat: ENSRNOG00000001225
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.