Anti FAM198B pAb (ATL-HPA007227 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA007227-25
  • Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus, nucleoli fibrillar center & the Golgi apparatus.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and FAM198B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY422154).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 198, member B
Gene Name: FAM198B
Alternative Gene Name: C4orf18, DKFZp434L142, FLJ38155
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027955: 81%, ENSRNOG00000010183: 79%
Entrez Gene ID: 51313
Uniprot ID: Q6UWH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRTRRNLLLGTACAIYLGFLVSQVGRASLQHGQAAEKGPHRSRDTAEPSFPEIPLDGTLAPPESQGNGSTLQPNVVYITLRSKRSKPANIRGTVKPKRRKKHAVASAAPGQEALVGPSLQPQEAAREADAVAPGYA
Gene Sequence PRTRRNLLLGTACAIYLGFLVSQVGRASLQHGQAAEKGPHRSRDTAEPSFPEIPLDGTLAPPESQGNGSTLQPNVVYITLRSKRSKPANIRGTVKPKRRKKHAVASAAPGQEALVGPSLQPQEAAREADAVAPGYA
Gene ID - Mouse ENSMUSG00000027955
Gene ID - Rat ENSRNOG00000010183
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti FAM198B pAb (ATL-HPA007227 w/enhanced validation)
Datasheet Anti FAM198B pAb (ATL-HPA007227 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM198B pAb (ATL-HPA007227 w/enhanced validation)



Citations for Anti FAM198B pAb (ATL-HPA007227 w/enhanced validation) – 1 Found
Lindskog, Cecilia; Korsgren, Olle; Pontén, Fredrik; Eriksson, Jan W; Johansson, Lars; Danielsson, Angelika. Novel pancreatic beta cell-specific proteins: antibody-based proteomics for identification of new biomarker candidates. Journal Of Proteomics. 2012;75(9):2611-20.  PubMed