Anti FAM196B pAb (ATL-HPA047227)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047227-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FAM196B
Alternative Gene Name: C5orf57
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069911: 84%, ENSRNOG00000032329: 87%
Entrez Gene ID: 100131897
Uniprot ID: A6NMK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AEVDVQTPEDPAVMGKTQATRHHLPPTYSLSFPRSQKAGGFRNIAIQTSPSLRKHFPVFKRKRLTASKSLVEMPTASQSAIQVNGN |
Gene Sequence | AEVDVQTPEDPAVMGKTQATRHHLPPTYSLSFPRSQKAGGFRNIAIQTSPSLRKHFPVFKRKRLTASKSLVEMPTASQSAIQVNGN |
Gene ID - Mouse | ENSMUSG00000069911 |
Gene ID - Rat | ENSRNOG00000032329 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FAM196B pAb (ATL-HPA047227) | |
Datasheet | Anti FAM196B pAb (ATL-HPA047227) Datasheet (External Link) |
Vendor Page | Anti FAM196B pAb (ATL-HPA047227) at Atlas Antibodies |
Documents & Links for Anti FAM196B pAb (ATL-HPA047227) | |
Datasheet | Anti FAM196B pAb (ATL-HPA047227) Datasheet (External Link) |
Vendor Page | Anti FAM196B pAb (ATL-HPA047227) |