Anti FAM196B pAb (ATL-HPA047227)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047227-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FAM196B
Alternative Gene Name: C5orf57
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069911: 84%, ENSRNOG00000032329: 87%
Entrez Gene ID: 100131897
Uniprot ID: A6NMK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AEVDVQTPEDPAVMGKTQATRHHLPPTYSLSFPRSQKAGGFRNIAIQTSPSLRKHFPVFKRKRLTASKSLVEMPTASQSAIQVNGN |
| Gene Sequence | AEVDVQTPEDPAVMGKTQATRHHLPPTYSLSFPRSQKAGGFRNIAIQTSPSLRKHFPVFKRKRLTASKSLVEMPTASQSAIQVNGN |
| Gene ID - Mouse | ENSMUSG00000069911 |
| Gene ID - Rat | ENSRNOG00000032329 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM196B pAb (ATL-HPA047227) | |
| Datasheet | Anti FAM196B pAb (ATL-HPA047227) Datasheet (External Link) |
| Vendor Page | Anti FAM196B pAb (ATL-HPA047227) at Atlas Antibodies |
| Documents & Links for Anti FAM196B pAb (ATL-HPA047227) | |
| Datasheet | Anti FAM196B pAb (ATL-HPA047227) Datasheet (External Link) |
| Vendor Page | Anti FAM196B pAb (ATL-HPA047227) |