Anti FAM196A pAb (ATL-HPA035899)

Atlas Antibodies

SKU:
ATL-HPA035899-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 196, member A
Gene Name: FAM196A
Alternative Gene Name: C10orf141, FLJ45557
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073805: 82%, ENSRNOG00000033881: 81%
Entrez Gene ID: 642938
Uniprot ID: Q6ZSG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VTKSTGVQTSPDLKKCYQTFPLDRKKGNLKSLPAADPFKSQNNGFLTDAKEKNEAGPMEEARPCGAGRVHKTTALVFHSNQHMNTVDQPLGVNCTEPCKSP
Gene Sequence VTKSTGVQTSPDLKKCYQTFPLDRKKGNLKSLPAADPFKSQNNGFLTDAKEKNEAGPMEEARPCGAGRVHKTTALVFHSNQHMNTVDQPLGVNCTEPCKSP
Gene ID - Mouse ENSMUSG00000073805
Gene ID - Rat ENSRNOG00000033881
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM196A pAb (ATL-HPA035899)
Datasheet Anti FAM196A pAb (ATL-HPA035899) Datasheet (External Link)
Vendor Page Anti FAM196A pAb (ATL-HPA035899) at Atlas Antibodies

Documents & Links for Anti FAM196A pAb (ATL-HPA035899)
Datasheet Anti FAM196A pAb (ATL-HPA035899) Datasheet (External Link)
Vendor Page Anti FAM196A pAb (ATL-HPA035899)