Anti FAM189B pAb (ATL-HPA050674)

Atlas Antibodies

Catalog No.:
ATL-HPA050674-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 189, member B
Gene Name: FAM189B
Alternative Gene Name: C1orf2, cote1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032657: 98%, ENSRNOG00000020518: 97%
Entrez Gene ID: 10712
Uniprot ID: P81408
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLYPTDCPPSYEAVMGLRGDSQATLFDPQLHDGSCICERVASIVDVSMDSGSLVLSAIGDLPGGSSPSEDSCLLELQGSVRSVDYVLFRSIQRSRAGYCLSLDCGLRGPFEESPLPRRPPRAARSYSCSA
Gene Sequence PLYPTDCPPSYEAVMGLRGDSQATLFDPQLHDGSCICERVASIVDVSMDSGSLVLSAIGDLPGGSSPSEDSCLLELQGSVRSVDYVLFRSIQRSRAGYCLSLDCGLRGPFEESPLPRRPPRAARSYSCSA
Gene ID - Mouse ENSMUSG00000032657
Gene ID - Rat ENSRNOG00000020518
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM189B pAb (ATL-HPA050674)
Datasheet Anti FAM189B pAb (ATL-HPA050674) Datasheet (External Link)
Vendor Page Anti FAM189B pAb (ATL-HPA050674) at Atlas Antibodies

Documents & Links for Anti FAM189B pAb (ATL-HPA050674)
Datasheet Anti FAM189B pAb (ATL-HPA050674) Datasheet (External Link)
Vendor Page Anti FAM189B pAb (ATL-HPA050674)