Anti FAM189B pAb (ATL-HPA050674)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050674-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FAM189B
Alternative Gene Name: C1orf2, cote1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032657: 98%, ENSRNOG00000020518: 97%
Entrez Gene ID: 10712
Uniprot ID: P81408
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PLYPTDCPPSYEAVMGLRGDSQATLFDPQLHDGSCICERVASIVDVSMDSGSLVLSAIGDLPGGSSPSEDSCLLELQGSVRSVDYVLFRSIQRSRAGYCLSLDCGLRGPFEESPLPRRPPRAARSYSCSA |
| Gene Sequence | PLYPTDCPPSYEAVMGLRGDSQATLFDPQLHDGSCICERVASIVDVSMDSGSLVLSAIGDLPGGSSPSEDSCLLELQGSVRSVDYVLFRSIQRSRAGYCLSLDCGLRGPFEESPLPRRPPRAARSYSCSA |
| Gene ID - Mouse | ENSMUSG00000032657 |
| Gene ID - Rat | ENSRNOG00000020518 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM189B pAb (ATL-HPA050674) | |
| Datasheet | Anti FAM189B pAb (ATL-HPA050674) Datasheet (External Link) |
| Vendor Page | Anti FAM189B pAb (ATL-HPA050674) at Atlas Antibodies |
| Documents & Links for Anti FAM189B pAb (ATL-HPA050674) | |
| Datasheet | Anti FAM189B pAb (ATL-HPA050674) Datasheet (External Link) |
| Vendor Page | Anti FAM189B pAb (ATL-HPA050674) |