Anti FAM189A2 pAb (ATL-HPA029411)

Atlas Antibodies

SKU:
ATL-HPA029411-25
  • Immunohistochemical staining of human gall bladder shows granular cytoplasmic positivity in glandular cells.
  • Western blot analysis in human skeletal muscle tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 189, member A2
Gene Name: FAM189A2
Alternative Gene Name: C9orf61, X123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071604: 93%, ENSRNOG00000061147: 91%
Entrez Gene ID: 9413
Uniprot ID: Q15884
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVLSCEAATQTERRLDLAAVTLRRGLRSRASRCRPRSLIDYKSYMDTKLLVARFLEQSSCTMTPDIHELVENIKSVLKSDEEHMEEAITSASFL
Gene Sequence PVLSCEAATQTERRLDLAAVTLRRGLRSRASRCRPRSLIDYKSYMDTKLLVARFLEQSSCTMTPDIHELVENIKSVLKSDEEHMEEAITSASFL
Gene ID - Mouse ENSMUSG00000071604
Gene ID - Rat ENSRNOG00000061147
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM189A2 pAb (ATL-HPA029411)
Datasheet Anti FAM189A2 pAb (ATL-HPA029411) Datasheet (External Link)
Vendor Page Anti FAM189A2 pAb (ATL-HPA029411) at Atlas Antibodies

Documents & Links for Anti FAM189A2 pAb (ATL-HPA029411)
Datasheet Anti FAM189A2 pAb (ATL-HPA029411) Datasheet (External Link)
Vendor Page Anti FAM189A2 pAb (ATL-HPA029411)