Anti FAM189A2 pAb (ATL-HPA029411)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029411-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FAM189A2
Alternative Gene Name: C9orf61, X123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071604: 93%, ENSRNOG00000061147: 91%
Entrez Gene ID: 9413
Uniprot ID: Q15884
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PVLSCEAATQTERRLDLAAVTLRRGLRSRASRCRPRSLIDYKSYMDTKLLVARFLEQSSCTMTPDIHELVENIKSVLKSDEEHMEEAITSASFL |
Gene Sequence | PVLSCEAATQTERRLDLAAVTLRRGLRSRASRCRPRSLIDYKSYMDTKLLVARFLEQSSCTMTPDIHELVENIKSVLKSDEEHMEEAITSASFL |
Gene ID - Mouse | ENSMUSG00000071604 |
Gene ID - Rat | ENSRNOG00000061147 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FAM189A2 pAb (ATL-HPA029411) | |
Datasheet | Anti FAM189A2 pAb (ATL-HPA029411) Datasheet (External Link) |
Vendor Page | Anti FAM189A2 pAb (ATL-HPA029411) at Atlas Antibodies |
Documents & Links for Anti FAM189A2 pAb (ATL-HPA029411) | |
Datasheet | Anti FAM189A2 pAb (ATL-HPA029411) Datasheet (External Link) |
Vendor Page | Anti FAM189A2 pAb (ATL-HPA029411) |