Anti FAM186B pAb (ATL-HPA039736)

Atlas Antibodies

Catalog No.: ATL-HPA039736-25

Protein Description: family with sequence similarity 186, member B
Gene Name: FAM186B
Alternative Gene Name: C12orf25, DKFZP434J0113
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078907: 64%, ENSRNOG00000054250: 64%
Entrez Gene ID: 84070
Uniprot ID: Q8IYM0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLIATKRGIESLTALCSTLIEGQKKRSQVSKRTFWQGWQGRSPQTSPSHPQPLSPEQMLQDQHTMNTKASEVTSMLQELLDSTMFSK
• Gene Sequence: SLIATKRGIESLTALCSTLIEGQKKRSQVSKRTFWQGWQGRSPQTSPSHPQPLSPEQMLQDQHTMNTKASEVTSMLQELLDSTMFSK
• Gene ID - Mouse: ENSMUSG00000078907
• Gene ID - Rat: ENSRNOG00000054250
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.