Anti FAM184B pAb (ATL-HPA048458)

Atlas Antibodies

SKU:
ATL-HPA048458-25
  • Immunohistochemical staining of human skeletal muscle shows moderate positivity in myocytes.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 184, member B
Gene Name: FAM184B
Alternative Gene Name: KIAA1276
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015879: 31%, ENSRNOG00000056009: 31%
Entrez Gene ID: 27146
Uniprot ID: Q9ULE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALNVKLQNSLLEVLRLEEFIQQNKTRPTGAEESPQELGRQHCSILETQDPCLKLDETSPRGEEYQDKLAAEEGTSSDEEERTKVLLKEGSDPQPPLGS
Gene Sequence ALNVKLQNSLLEVLRLEEFIQQNKTRPTGAEESPQELGRQHCSILETQDPCLKLDETSPRGEEYQDKLAAEEGTSSDEEERTKVLLKEGSDPQPPLGS
Gene ID - Mouse ENSMUSG00000015879
Gene ID - Rat ENSRNOG00000056009
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM184B pAb (ATL-HPA048458)
Datasheet Anti FAM184B pAb (ATL-HPA048458) Datasheet (External Link)
Vendor Page Anti FAM184B pAb (ATL-HPA048458) at Atlas Antibodies

Documents & Links for Anti FAM184B pAb (ATL-HPA048458)
Datasheet Anti FAM184B pAb (ATL-HPA048458) Datasheet (External Link)
Vendor Page Anti FAM184B pAb (ATL-HPA048458)