Anti FAM183A pAb (ATL-HPA049120)

Atlas Antibodies

Catalog No.:
ATL-HPA049120-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 183, member A
Gene Name: FAM183A
Alternative Gene Name: hCG23177, LOC440585
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049154: 88%, ENSRNOG00000002873: 85%
Entrez Gene ID: 440585
Uniprot ID: A6NL82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PMSWHDNLEEPADARFLNLIHHAAQGPTKKYPE
Gene Sequence PMSWHDNLEEPADARFLNLIHHAAQGPTKKYPE
Gene ID - Mouse ENSMUSG00000049154
Gene ID - Rat ENSRNOG00000002873
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM183A pAb (ATL-HPA049120)
Datasheet Anti FAM183A pAb (ATL-HPA049120) Datasheet (External Link)
Vendor Page Anti FAM183A pAb (ATL-HPA049120) at Atlas Antibodies

Documents & Links for Anti FAM183A pAb (ATL-HPA049120)
Datasheet Anti FAM183A pAb (ATL-HPA049120) Datasheet (External Link)
Vendor Page Anti FAM183A pAb (ATL-HPA049120)