Anti FAM182B pAb (ATL-HPA050100)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050100-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FAM182B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022095: 33%, ENSRNOG00000020363: 32%
Entrez Gene ID: 728882
Uniprot ID: Q5T319
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WGGQHCGCPAKSLPGPHPGGVSAPQSASQLMVKLLVWQKSVHKLRKI |
| Gene Sequence | WGGQHCGCPAKSLPGPHPGGVSAPQSASQLMVKLLVWQKSVHKLRKI |
| Gene ID - Mouse | ENSMUSG00000022095 |
| Gene ID - Rat | ENSRNOG00000020363 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM182B pAb (ATL-HPA050100) | |
| Datasheet | Anti FAM182B pAb (ATL-HPA050100) Datasheet (External Link) |
| Vendor Page | Anti FAM182B pAb (ATL-HPA050100) at Atlas Antibodies |
| Documents & Links for Anti FAM182B pAb (ATL-HPA050100) | |
| Datasheet | Anti FAM182B pAb (ATL-HPA050100) Datasheet (External Link) |
| Vendor Page | Anti FAM182B pAb (ATL-HPA050100) |