Anti FAM177B pAb (ATL-HPA063059)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063059-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FAM177B
Alternative Gene Name: FLJ43505, RP11-452F19.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022565: 28%, ENSRNOG00000058348: 48%
Entrez Gene ID: 400823
Uniprot ID: A6PVY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TQPKYQYVLNEFYRIQNKKSDNKSERRGSKAQAAEVPNEKCHLEAGVREYGTIQQDVTEAIPQ |
Gene Sequence | TQPKYQYVLNEFYRIQNKKSDNKSERRGSKAQAAEVPNEKCHLEAGVREYGTIQQDVTEAIPQ |
Gene ID - Mouse | ENSMUSG00000022565 |
Gene ID - Rat | ENSRNOG00000058348 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FAM177B pAb (ATL-HPA063059) | |
Datasheet | Anti FAM177B pAb (ATL-HPA063059) Datasheet (External Link) |
Vendor Page | Anti FAM177B pAb (ATL-HPA063059) at Atlas Antibodies |
Documents & Links for Anti FAM177B pAb (ATL-HPA063059) | |
Datasheet | Anti FAM177B pAb (ATL-HPA063059) Datasheet (External Link) |
Vendor Page | Anti FAM177B pAb (ATL-HPA063059) |