Anti FAM177A1 pAb (ATL-HPA055440)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055440-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FAM177A1
Alternative Gene Name: C14orf24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094103: 86%, ENSRNOG00000046391: 86%
Entrez Gene ID: 283635
Uniprot ID: Q8N128
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ESAGQMSNERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYSTDEDEVDGVEKKDV |
| Gene Sequence | ESAGQMSNERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYSTDEDEVDGVEKKDV |
| Gene ID - Mouse | ENSMUSG00000094103 |
| Gene ID - Rat | ENSRNOG00000046391 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM177A1 pAb (ATL-HPA055440) | |
| Datasheet | Anti FAM177A1 pAb (ATL-HPA055440) Datasheet (External Link) |
| Vendor Page | Anti FAM177A1 pAb (ATL-HPA055440) at Atlas Antibodies |
| Documents & Links for Anti FAM177A1 pAb (ATL-HPA055440) | |
| Datasheet | Anti FAM177A1 pAb (ATL-HPA055440) Datasheet (External Link) |
| Vendor Page | Anti FAM177A1 pAb (ATL-HPA055440) |