Anti FAM177A1 pAb (ATL-HPA055440)

Atlas Antibodies

Catalog No.: ATL-HPA055440-25

Protein Description: family with sequence similarity 177, member A1
Gene Name: FAM177A1
Alternative Gene Name: C14orf24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094103: 86%, ENSRNOG00000046391: 86%
Entrez Gene ID: 283635
Uniprot ID: Q8N128
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESAGQMSNERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYSTDEDEVDGVEKKDV
• Gene Sequence: ESAGQMSNERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYSTDEDEVDGVEKKDV
• Gene ID - Mouse: ENSMUSG00000094103
• Gene ID - Rat: ENSRNOG00000046391
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.