Anti FAM177A1 pAb (ATL-HPA053222)

Atlas Antibodies

Catalog No.:
ATL-HPA053222-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 177, member A1
Gene Name: FAM177A1
Alternative Gene Name: C14orf24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094103: 83%, ENSRNOG00000046391: 80%
Entrez Gene ID: 283635
Uniprot ID: Q8N128
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NRMSEEAEKQYQQNKLQTDSIVQTDQPETVISSSFVNVNFEMEGDSEVIMESKQNPVSVP
Gene Sequence NRMSEEAEKQYQQNKLQTDSIVQTDQPETVISSSFVNVNFEMEGDSEVIMESKQNPVSVP
Gene ID - Mouse ENSMUSG00000094103
Gene ID - Rat ENSRNOG00000046391
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM177A1 pAb (ATL-HPA053222)
Datasheet Anti FAM177A1 pAb (ATL-HPA053222) Datasheet (External Link)
Vendor Page Anti FAM177A1 pAb (ATL-HPA053222) at Atlas Antibodies

Documents & Links for Anti FAM177A1 pAb (ATL-HPA053222)
Datasheet Anti FAM177A1 pAb (ATL-HPA053222) Datasheet (External Link)
Vendor Page Anti FAM177A1 pAb (ATL-HPA053222)