Anti FAM174B pAb (ATL-HPA015306)

Atlas Antibodies

Catalog No.: ATL-HPA015306-25

Protein Description: family with sequence similarity 174, member B
Gene Name: FAM174B
Alternative Gene Name: LOC400451, MGC102891
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078670: 98%, ENSRNOG00000012369: 86%
Entrez Gene ID: 400451
Uniprot ID: Q3ZCQ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGKRLKKTRKYDIITTPAERVEMAPLNEEDDEDEDSTVFDIKYR
• Gene Sequence: SGKRLKKTRKYDIITTPAERVEMAPLNEEDDEDEDSTVFDIKYR
• Gene ID - Mouse: ENSMUSG00000078670
• Gene ID - Rat: ENSRNOG00000012369
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.