Anti FAM170B pAb (ATL-HPA050610)

Atlas Antibodies

Catalog No.:
ATL-HPA050610-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 170, member B
Gene Name: FAM170B
Alternative Gene Name: C10orf73, Em:AC084727.4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078127: 73%, ENSRNOG00000020077: 73%
Entrez Gene ID: 170370
Uniprot ID: A6NMN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSSESSEYQSYSQYQSCCSCMCDEDNAAPQSVCAFYTHVQTVRGVAVAWETEAGFEPVTRKPRIHEAQFIKRQRWNGS
Gene Sequence PSSESSEYQSYSQYQSCCSCMCDEDNAAPQSVCAFYTHVQTVRGVAVAWETEAGFEPVTRKPRIHEAQFIKRQRWNGS
Gene ID - Mouse ENSMUSG00000078127
Gene ID - Rat ENSRNOG00000020077
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM170B pAb (ATL-HPA050610)
Datasheet Anti FAM170B pAb (ATL-HPA050610) Datasheet (External Link)
Vendor Page Anti FAM170B pAb (ATL-HPA050610) at Atlas Antibodies

Documents & Links for Anti FAM170B pAb (ATL-HPA050610)
Datasheet Anti FAM170B pAb (ATL-HPA050610) Datasheet (External Link)
Vendor Page Anti FAM170B pAb (ATL-HPA050610)