Anti FAM170B pAb (ATL-HPA043899)

Atlas Antibodies

Catalog No.: ATL-HPA043899-25

Protein Description: family with sequence similarity 170, member B
Gene Name: FAM170B
Alternative Gene Name: C10orf73, Em:AC084727.4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078127: 64%, ENSRNOG00000020077: 69%
Entrez Gene ID: 170370
Uniprot ID: A6NMN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GIREGFSCQIFFEEMLERRRAQGQAHDQQLEEEQSPSDNSECSRPQGEVLSAQQQEKQ
• Gene Sequence: GIREGFSCQIFFEEMLERRRAQGQAHDQQLEEEQSPSDNSECSRPQGEVLSAQQQEKQ
• Gene ID - Mouse: ENSMUSG00000078127
• Gene ID - Rat: ENSRNOG00000020077
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.