Anti FAM170B pAb (ATL-HPA043899)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043899-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FAM170B
Alternative Gene Name: C10orf73, Em:AC084727.4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078127: 64%, ENSRNOG00000020077: 69%
Entrez Gene ID: 170370
Uniprot ID: A6NMN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GIREGFSCQIFFEEMLERRRAQGQAHDQQLEEEQSPSDNSECSRPQGEVLSAQQQEKQ |
| Gene Sequence | GIREGFSCQIFFEEMLERRRAQGQAHDQQLEEEQSPSDNSECSRPQGEVLSAQQQEKQ |
| Gene ID - Mouse | ENSMUSG00000078127 |
| Gene ID - Rat | ENSRNOG00000020077 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM170B pAb (ATL-HPA043899) | |
| Datasheet | Anti FAM170B pAb (ATL-HPA043899) Datasheet (External Link) |
| Vendor Page | Anti FAM170B pAb (ATL-HPA043899) at Atlas Antibodies |
| Documents & Links for Anti FAM170B pAb (ATL-HPA043899) | |
| Datasheet | Anti FAM170B pAb (ATL-HPA043899) Datasheet (External Link) |
| Vendor Page | Anti FAM170B pAb (ATL-HPA043899) |