Anti FAM167B pAb (ATL-HPA062074)

Atlas Antibodies

Catalog No.: ATL-HPA062074-25

Protein Description: family with sequence similarity 167, member B
Gene Name: FAM167B
Alternative Gene Name: C1orf90, MGC10820
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050493: 84%, ENSRNOG00000049425: 84%
Entrez Gene ID: 84734
Uniprot ID: Q9BTA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSYLEWTAQVQSQAWRRAQAKPGPGGPGDICGFDSMDSALEWLRRELREM
• Gene Sequence: PSYLEWTAQVQSQAWRRAQAKPGPGGPGDICGFDSMDSALEWLRRELREM
• Gene ID - Mouse: ENSMUSG00000050493
• Gene ID - Rat: ENSRNOG00000049425
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.