Anti FAM167B pAb (ATL-HPA062074)

Atlas Antibodies

Catalog No.:
ATL-HPA062074-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 167, member B
Gene Name: FAM167B
Alternative Gene Name: C1orf90, MGC10820
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050493: 84%, ENSRNOG00000049425: 84%
Entrez Gene ID: 84734
Uniprot ID: Q9BTA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSYLEWTAQVQSQAWRRAQAKPGPGGPGDICGFDSMDSALEWLRRELREM
Gene Sequence PSYLEWTAQVQSQAWRRAQAKPGPGGPGDICGFDSMDSALEWLRRELREM
Gene ID - Mouse ENSMUSG00000050493
Gene ID - Rat ENSRNOG00000049425
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM167B pAb (ATL-HPA062074)
Datasheet Anti FAM167B pAb (ATL-HPA062074) Datasheet (External Link)
Vendor Page Anti FAM167B pAb (ATL-HPA062074) at Atlas Antibodies

Documents & Links for Anti FAM167B pAb (ATL-HPA062074)
Datasheet Anti FAM167B pAb (ATL-HPA062074) Datasheet (External Link)
Vendor Page Anti FAM167B pAb (ATL-HPA062074)