Anti FAM163B pAb (ATL-HPA067336)

Atlas Antibodies

Catalog No.:
ATL-HPA067336-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 163, member B
Gene Name: FAM163B
Alternative Gene Name: C9orf166
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009216: 86%, ENSRNOG00000006591: 85%
Entrez Gene ID: 642968
Uniprot ID: P0C2L3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEEPDFAVHSHLPPLHSNRNLVLTNGPALYPTASTSFSQKSPQARALCRSCSHCEPPTFFLQEPPEEEEDVLNGGERVLYKSVSQE
Gene Sequence EEEPDFAVHSHLPPLHSNRNLVLTNGPALYPTASTSFSQKSPQARALCRSCSHCEPPTFFLQEPPEEEEDVLNGGERVLYKSVSQE
Gene ID - Mouse ENSMUSG00000009216
Gene ID - Rat ENSRNOG00000006591
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM163B pAb (ATL-HPA067336)
Datasheet Anti FAM163B pAb (ATL-HPA067336) Datasheet (External Link)
Vendor Page Anti FAM163B pAb (ATL-HPA067336) at Atlas Antibodies

Documents & Links for Anti FAM163B pAb (ATL-HPA067336)
Datasheet Anti FAM163B pAb (ATL-HPA067336) Datasheet (External Link)
Vendor Page Anti FAM163B pAb (ATL-HPA067336)