Anti FAM161B pAb (ATL-HPA019125)

Atlas Antibodies

SKU:
ATL-HPA019125-25
  • Immunohistochemical staining of human pancreas shows cytoplasmic and nuclear positivity in exocrine glandular cells.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 161, member B
Gene Name: FAM161B
Alternative Gene Name: C14orf44, FLJ31697
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021234: 66%, ENSRNOG00000011112: 67%
Entrez Gene ID: 145483
Uniprot ID: Q96MY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSRQIFPPESFADTEAGEELSGDGLVLPRASKLDEFLSPEEEIDSTSDSTGSIYQNLQELKQKGRWCLLESLFQSDPESDENLSEDEEDLESFFQDKDRGMVQVQCPQALRCGSTRRCSSLNNLPSNIPRPQTQPPS
Gene Sequence GSRQIFPPESFADTEAGEELSGDGLVLPRASKLDEFLSPEEEIDSTSDSTGSIYQNLQELKQKGRWCLLESLFQSDPESDENLSEDEEDLESFFQDKDRGMVQVQCPQALRCGSTRRCSSLNNLPSNIPRPQTQPPS
Gene ID - Mouse ENSMUSG00000021234
Gene ID - Rat ENSRNOG00000011112
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM161B pAb (ATL-HPA019125)
Datasheet Anti FAM161B pAb (ATL-HPA019125) Datasheet (External Link)
Vendor Page Anti FAM161B pAb (ATL-HPA019125) at Atlas Antibodies

Documents & Links for Anti FAM161B pAb (ATL-HPA019125)
Datasheet Anti FAM161B pAb (ATL-HPA019125) Datasheet (External Link)
Vendor Page Anti FAM161B pAb (ATL-HPA019125)



Citations for Anti FAM161B pAb (ATL-HPA019125) – 1 Found
Longhi, M T; Silva, L E; Pereira, M; Magalhães, M; Reina, J; Vitorino, F N L; Gumbiner, B M; da Cunha, J P C; Cella, N. PI3K-AKT, JAK2-STAT3 pathways and cell-cell contact regulate maspin subcellular localization. Cell Communication And Signaling : Ccs. 2021;19(1):86.  PubMed