Anti FAM160B2 pAb (ATL-HPA025040)

Atlas Antibodies

SKU:
ATL-HPA025040-25
  • Immunohistochemical staining of human skin shows strong cytoplasmic positivity in fibroblasts, keratinocytes and Langerhans.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 160, member B2
Gene Name: FAM160B2
Alternative Gene Name: FLJ21801, RAI16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022095: 85%, ENSRNOG00000012014: 84%
Entrez Gene ID: 64760
Uniprot ID: Q86V87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen IIHSLVLRNLEGRPYVAWGSPEPESYEDTLDLEEDPYFTDSFLDSGFQTPAKPRLAPATSYDGKTAVTEIVNSFLCLVPEEAKTSA
Gene Sequence IIHSLVLRNLEGRPYVAWGSPEPESYEDTLDLEEDPYFTDSFLDSGFQTPAKPRLAPATSYDGKTAVTEIVNSFLCLVPEEAKTSA
Gene ID - Mouse ENSMUSG00000022095
Gene ID - Rat ENSRNOG00000012014
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM160B2 pAb (ATL-HPA025040)
Datasheet Anti FAM160B2 pAb (ATL-HPA025040) Datasheet (External Link)
Vendor Page Anti FAM160B2 pAb (ATL-HPA025040) at Atlas Antibodies

Documents & Links for Anti FAM160B2 pAb (ATL-HPA025040)
Datasheet Anti FAM160B2 pAb (ATL-HPA025040) Datasheet (External Link)
Vendor Page Anti FAM160B2 pAb (ATL-HPA025040)