Anti FAM160A2 pAb (ATL-HPA055994)

Atlas Antibodies

Catalog No.: ATL-HPA055994-25

Protein Description: family with sequence similarity 160, member A2
Gene Name: FAM160A2
Alternative Gene Name: C11orf56, DKFZP566M1046, FLJ22665, KIAA1759
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044465: 75%, ENSRNOG00000042195: 32%
Entrez Gene ID: 84067
Uniprot ID: Q8N612
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSRTKKRSLLPEEDRNNVGEGEEEELGRRGRAGGAGEGPGHLPPPQLNGVPGSWPEGAKKVRLVPKEGAGELL
• Gene Sequence: GSRTKKRSLLPEEDRNNVGEGEEEELGRRGRAGGAGEGPGHLPPPQLNGVPGSWPEGAKKVRLVPKEGAGELL
• Gene ID - Mouse: ENSMUSG00000044465
• Gene ID - Rat: ENSRNOG00000042195
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.