Anti FAM159B pAb (ATL-HPA011778)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011778-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FAM159B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042655: 74%, ENSRNOG00000013372: 77%
Entrez Gene ID: 100132916
Uniprot ID: A6NKW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TKPQRLDTGLKLQHLEASSTQEGKSNGKTKALNSNAASNATNETYYEADDIIQEKTMDATQIHIA |
Gene Sequence | TKPQRLDTGLKLQHLEASSTQEGKSNGKTKALNSNAASNATNETYYEADDIIQEKTMDATQIHIA |
Gene ID - Mouse | ENSMUSG00000042655 |
Gene ID - Rat | ENSRNOG00000013372 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FAM159B pAb (ATL-HPA011778) | |
Datasheet | Anti FAM159B pAb (ATL-HPA011778) Datasheet (External Link) |
Vendor Page | Anti FAM159B pAb (ATL-HPA011778) at Atlas Antibodies |
Documents & Links for Anti FAM159B pAb (ATL-HPA011778) | |
Datasheet | Anti FAM159B pAb (ATL-HPA011778) Datasheet (External Link) |
Vendor Page | Anti FAM159B pAb (ATL-HPA011778) |
Citations for Anti FAM159B pAb (ATL-HPA011778) – 1 Found |
Beyer, Anna-Sophia Lieselott; Kaemmerer, Daniel; Sänger, Jörg; Evert, Katja; Lupp, Amelie. Immunohistochemical Evaluation of Adaptor Protein FAM159B Expression in Normal and Neoplastic Human Tissues. International Journal Of Molecular Sciences. 2021;22(22) PubMed |