Anti FAM159B pAb (ATL-HPA011778)

Atlas Antibodies

SKU: ATL-HPA011778-25

• 

Protein Description: family with sequence similarity 159, member B
Gene Name: FAM159B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042655: 74%, ENSRNOG00000013372: 77%
Entrez Gene ID: 100132916
Uniprot ID: A6NKW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TKPQRLDTGLKLQHLEASSTQEGKSNGKTKALNSNAASNATNETYYEADDIIQEKTMDATQIHIA
• Gene Sequence: TKPQRLDTGLKLQHLEASSTQEGKSNGKTKALNSNAASNATNETYYEADDIIQEKTMDATQIHIA
• Gene ID - Mouse: ENSMUSG00000042655
• Gene ID - Rat: ENSRNOG00000013372
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAM159B pAb (ATL-HPA011778) – 1 Found

Beyer, Anna-Sophia Lieselott; Kaemmerer, Daniel; Sänger, Jörg; Evert, Katja; Lupp, Amelie. Immunohistochemical Evaluation of Adaptor Protein FAM159B Expression in Normal and Neoplastic Human Tissues. International Journal Of Molecular Sciences. 2021;22(22)