Anti FAM159A pAb (ATL-HPA030744 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA030744-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and FAM159A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY421028).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 159, member A
Gene Name: FAM159A
Alternative Gene Name: MGC52498
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059816: 54%, ENSRNOG00000030641: 59%
Entrez Gene ID: 348378
Uniprot ID: Q6UWV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLDLGLSLQTAGPEEVSPDCQGVNTGMAAEVPKVSPLQQSYSCLNPQLESNEGQAVNSKRLLHHCFMATVTTSD
Gene Sequence KLDLGLSLQTAGPEEVSPDCQGVNTGMAAEVPKVSPLQQSYSCLNPQLESNEGQAVNSKRLLHHCFMATVTTSD
Gene ID - Mouse ENSMUSG00000059816
Gene ID - Rat ENSRNOG00000030641
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti FAM159A pAb (ATL-HPA030744 w/enhanced validation)
Datasheet Anti FAM159A pAb (ATL-HPA030744 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM159A pAb (ATL-HPA030744 w/enhanced validation)