Anti FAM159A pAb (ATL-HPA030744 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030744-25

Protein Description: family with sequence similarity 159, member A
Gene Name: FAM159A
Alternative Gene Name: MGC52498
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059816: 54%, ENSRNOG00000030641: 59%
Entrez Gene ID: 348378
Uniprot ID: Q6UWV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLDLGLSLQTAGPEEVSPDCQGVNTGMAAEVPKVSPLQQSYSCLNPQLESNEGQAVNSKRLLHHCFMATVTTSD
• Gene Sequence: KLDLGLSLQTAGPEEVSPDCQGVNTGMAAEVPKVSPLQQSYSCLNPQLESNEGQAVNSKRLLHHCFMATVTTSD
• Gene ID - Mouse: ENSMUSG00000059816
• Gene ID - Rat: ENSRNOG00000030641
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.