Anti FAM156A pAb (ATL-HPA056643)

Atlas Antibodies

Catalog No.:
ATL-HPA056643-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 156, member A
Gene Name: FAM156A
Alternative Gene Name: PRO0659, TMEM29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041353: 63%, ENSRNOG00000048516: 63%
Entrez Gene ID: 29057
Uniprot ID: Q8NDB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSSWETLVQGLSGLTLSLGTNQPGPLPEAALQPQETEEKRQRERQQESKIMFQRLLKQWLEE
Gene Sequence PSSWETLVQGLSGLTLSLGTNQPGPLPEAALQPQETEEKRQRERQQESKIMFQRLLKQWLEE
Gene ID - Mouse ENSMUSG00000041353
Gene ID - Rat ENSRNOG00000048516
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM156A pAb (ATL-HPA056643)
Datasheet Anti FAM156A pAb (ATL-HPA056643) Datasheet (External Link)
Vendor Page Anti FAM156A pAb (ATL-HPA056643) at Atlas Antibodies

Documents & Links for Anti FAM156A pAb (ATL-HPA056643)
Datasheet Anti FAM156A pAb (ATL-HPA056643) Datasheet (External Link)
Vendor Page Anti FAM156A pAb (ATL-HPA056643)