Anti FAM153B pAb (ATL-HPA046691)

Atlas Antibodies

Catalog No.:
ATL-HPA046691-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 153, member B
Gene Name: FAM153B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078721: 38%, ENSRNOG00000017069: 35%
Entrez Gene ID: 202134
Uniprot ID: P0C7A2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRGDLEDLEEHVPGQTVSEEATGVHMMQVDPATPAKS
Gene Sequence QRGDLEDLEEHVPGQTVSEEATGVHMMQVDPATPAKS
Gene ID - Mouse ENSMUSG00000078721
Gene ID - Rat ENSRNOG00000017069
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM153B pAb (ATL-HPA046691)
Datasheet Anti FAM153B pAb (ATL-HPA046691) Datasheet (External Link)
Vendor Page Anti FAM153B pAb (ATL-HPA046691) at Atlas Antibodies

Documents & Links for Anti FAM153B pAb (ATL-HPA046691)
Datasheet Anti FAM153B pAb (ATL-HPA046691) Datasheet (External Link)
Vendor Page Anti FAM153B pAb (ATL-HPA046691)