Anti FAM13B pAb (ATL-HPA071936)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071936-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FAM13B
Alternative Gene Name: ARHGAP49, C5orf5, FAM13B1, KHCHP, N61
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036501: 100%, ENSRNOG00000020384: 100%
Entrez Gene ID: 51306
Uniprot ID: Q9NYF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YSLLKFLCRFLANVASHHEEIWSANSLAAVFGPDVFHIYTDVEDMKEQEIVSRIMAGLLENYYEFFENEEEDFSSNDLSSI |
| Gene Sequence | YSLLKFLCRFLANVASHHEEIWSANSLAAVFGPDVFHIYTDVEDMKEQEIVSRIMAGLLENYYEFFENEEEDFSSNDLSSI |
| Gene ID - Mouse | ENSMUSG00000036501 |
| Gene ID - Rat | ENSRNOG00000020384 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM13B pAb (ATL-HPA071936) | |
| Datasheet | Anti FAM13B pAb (ATL-HPA071936) Datasheet (External Link) |
| Vendor Page | Anti FAM13B pAb (ATL-HPA071936) at Atlas Antibodies |
| Documents & Links for Anti FAM13B pAb (ATL-HPA071936) | |
| Datasheet | Anti FAM13B pAb (ATL-HPA071936) Datasheet (External Link) |
| Vendor Page | Anti FAM13B pAb (ATL-HPA071936) |