Anti FAM13B pAb (ATL-HPA071936)

Atlas Antibodies

SKU:
ATL-HPA071936-25
  • Immunohistochemical staining of human testis shows cytoplasmic positivity in seminiferous ducts.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 13, member B
Gene Name: FAM13B
Alternative Gene Name: ARHGAP49, C5orf5, FAM13B1, KHCHP, N61
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036501: 100%, ENSRNOG00000020384: 100%
Entrez Gene ID: 51306
Uniprot ID: Q9NYF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YSLLKFLCRFLANVASHHEEIWSANSLAAVFGPDVFHIYTDVEDMKEQEIVSRIMAGLLENYYEFFENEEEDFSSNDLSSI
Gene Sequence YSLLKFLCRFLANVASHHEEIWSANSLAAVFGPDVFHIYTDVEDMKEQEIVSRIMAGLLENYYEFFENEEEDFSSNDLSSI
Gene ID - Mouse ENSMUSG00000036501
Gene ID - Rat ENSRNOG00000020384
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM13B pAb (ATL-HPA071936)
Datasheet Anti FAM13B pAb (ATL-HPA071936) Datasheet (External Link)
Vendor Page Anti FAM13B pAb (ATL-HPA071936) at Atlas Antibodies

Documents & Links for Anti FAM13B pAb (ATL-HPA071936)
Datasheet Anti FAM13B pAb (ATL-HPA071936) Datasheet (External Link)
Vendor Page Anti FAM13B pAb (ATL-HPA071936)