Anti FAM13A pAb (ATL-HPA038109)

Atlas Antibodies

Catalog No.:
ATL-HPA038109-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 13, member A
Gene Name: FAM13A
Alternative Gene Name: ARHGAP48, FAM13A1, KIAA0914
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037709: 87%, ENSRNOG00000007947: 86%
Entrez Gene ID: 10144
Uniprot ID: O94988
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TDFSARCFLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLEHLQEMREEKKRIRKKLRDFE
Gene Sequence TDFSARCFLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLEHLQEMREEKKRIRKKLRDFE
Gene ID - Mouse ENSMUSG00000037709
Gene ID - Rat ENSRNOG00000007947
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM13A pAb (ATL-HPA038109)
Datasheet Anti FAM13A pAb (ATL-HPA038109) Datasheet (External Link)
Vendor Page Anti FAM13A pAb (ATL-HPA038109) at Atlas Antibodies

Documents & Links for Anti FAM13A pAb (ATL-HPA038109)
Datasheet Anti FAM13A pAb (ATL-HPA038109) Datasheet (External Link)
Vendor Page Anti FAM13A pAb (ATL-HPA038109)
Citations for Anti FAM13A pAb (ATL-HPA038109) – 6 Found
Miller, S; Melén, E; Merid, S K; Hall, I P; Sayers, I. Genes associated with polymorphic variants predicting lung function are differentially expressed during human lung development. Respiratory Research. 2016;17(1):95.  PubMed
Eisenhut, Felix; Heim, Lisanne; Trump, Sonja; Mittler, Susanne; Sopel, Nina; Andreev, Katerina; Ferrazzi, Fulvia; Ekici, Arif B; Rieker, Ralf; Springel, Rebekka; Assmann, Vera L; Lechmann, Matthias; Koch, Sonja; Engelhardt, Marina; Warnecke, Christina; Trufa, Denis I; Sirbu, Horia; Hartmann, Arndt; Finotto, Susetta. FAM13A is associated with non-small cell lung cancer (NSCLC) progression and controls tumor cell proliferation and survival. Oncoimmunology. 6(1):e1256526.  PubMed
Tang, Jiazhen; Zhou, Hongyi; Sahay, Khushboo; Xu, Wenqiong; Yang, Jing; Zhang, Wei; Chen, Weiqin. Obesity-associated family with sequence similarity 13, member A (FAM13A) is dispensable for adipose development and insulin sensitivity. International Journal Of Obesity (2005). 2019;43(6):1269-1280.  PubMed
Zhang, Yingai; Wang, Shunlan; Wang, Chan; Xiao, Jingchuan; Zhang, Shufang; Zhou, Hailong. High expression of FAM13A was associated with increasing the liver cirrhosis risk. Molecular Genetics & Genomic Medicine. 2019;7(3):e543.  PubMed
Zhu, Jinyuan; Wang, Faxuan; Feng, Xueyan; Li, Beibei; Ma, Liqiong; Zhang, Jin. Family with sequence similarity 13 member A mediates TGF-β1-induced EMT in small airway epithelium of patients with chronic obstructive pulmonary disease. Respiratory Research. 2021;22(1):192.  PubMed
Jin, Zhigang; Chung, Jin Wei; Mei, Wenyan; Strack, Stefan; He, Chunyan; Lau, Gee W; Yang, Jing. Regulation of nuclear-cytoplasmic shuttling and function of Family with sequence similarity 13, member A (Fam13a), by B56-containing PP2As and Akt. Molecular Biology Of The Cell. 2015;26(6):1160-73.  PubMed