Anti FAM136A pAb (ATL-HPA030104 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030104-25

Protein Description: family with sequence similarity 136, member A
Gene Name: FAM136A
Alternative Gene Name: FLJ14668
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057497: 88%, ENSRNOG00000016273: 88%
Entrez Gene ID: 84908
Uniprot ID: Q96C01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVT
• Gene Sequence: MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVT
• Gene ID - Mouse: ENSMUSG00000057497
• Gene ID - Rat: ENSRNOG00000016273
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.