Anti FAM135B pAb (ATL-HPA023950)

Atlas Antibodies

SKU:
ATL-HPA023950-25
  • Immunohistochemical staining of human small intestine shows strong nuclear membrane positivity and slightly weaker cytoplasmic staining in glandular cells.
  • Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm & nuclear membrane.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 135, member B
Gene Name: FAM135B
Alternative Gene Name: C8ORFK32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036800: 47%, ENSRNOG00000005159: 44%
Entrez Gene ID: 51059
Uniprot ID: Q49AJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SAPHISSPEEAAEDADTKQQDGGFAEPSDMHSKSQGSPGSCSQLCGDSGTDAGADHPLVEIVLDADNQQGPGYIDIPKGKGKQFDAQGHCLPDGRTEN
Gene Sequence SAPHISSPEEAAEDADTKQQDGGFAEPSDMHSKSQGSPGSCSQLCGDSGTDAGADHPLVEIVLDADNQQGPGYIDIPKGKGKQFDAQGHCLPDGRTEN
Gene ID - Mouse ENSMUSG00000036800
Gene ID - Rat ENSRNOG00000005159
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM135B pAb (ATL-HPA023950)
Datasheet Anti FAM135B pAb (ATL-HPA023950) Datasheet (External Link)
Vendor Page Anti FAM135B pAb (ATL-HPA023950) at Atlas Antibodies

Documents & Links for Anti FAM135B pAb (ATL-HPA023950)
Datasheet Anti FAM135B pAb (ATL-HPA023950) Datasheet (External Link)
Vendor Page Anti FAM135B pAb (ATL-HPA023950)