Anti FAM133B pAb (ATL-HPA069513)

Atlas Antibodies

Catalog No.:
ATL-HPA069513-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 133, member B
Gene Name: FAM133B
Alternative Gene Name: MGC40405
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058503: 100%, ENSRNOG00000009163: 100%
Entrez Gene ID: 257415
Uniprot ID: Q5BKY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AMARSRGPIQSSGPTIQDYLNRPRPTWEEV
Gene Sequence AMARSRGPIQSSGPTIQDYLNRPRPTWEEV
Gene ID - Mouse ENSMUSG00000058503
Gene ID - Rat ENSRNOG00000009163
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM133B pAb (ATL-HPA069513)
Datasheet Anti FAM133B pAb (ATL-HPA069513) Datasheet (External Link)
Vendor Page Anti FAM133B pAb (ATL-HPA069513) at Atlas Antibodies

Documents & Links for Anti FAM133B pAb (ATL-HPA069513)
Datasheet Anti FAM133B pAb (ATL-HPA069513) Datasheet (External Link)
Vendor Page Anti FAM133B pAb (ATL-HPA069513)