Anti FAM129A pAb (ATL-HPA028172)

Atlas Antibodies

SKU: ATL-HPA028172-25

• 

Protein Description: family with sequence similarity 129, member A
Gene Name: FAM129A
Alternative Gene Name: C1orf24, GIG39, NIBAN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026483: 82%, ENSRNOG00000002403: 83%
Entrez Gene ID: 116496
Uniprot ID: Q9BZQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VESYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKENTQPFVVLPKEFPVYLWQPFFRHGYFCFHEAADQKRFSALLS
• Gene Sequence: VESYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKENTQPFVVLPKEFPVYLWQPFFRHGYFCFHEAADQKRFSALLS
• Gene ID - Mouse: ENSMUSG00000026483
• Gene ID - Rat: ENSRNOG00000002403
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.