Anti FAM129A pAb (ATL-HPA028172)

Atlas Antibodies

Catalog No.:
ATL-HPA028172-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 129, member A
Gene Name: FAM129A
Alternative Gene Name: C1orf24, GIG39, NIBAN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026483: 82%, ENSRNOG00000002403: 83%
Entrez Gene ID: 116496
Uniprot ID: Q9BZQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VESYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKENTQPFVVLPKEFPVYLWQPFFRHGYFCFHEAADQKRFSALLS
Gene Sequence VESYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKENTQPFVVLPKEFPVYLWQPFFRHGYFCFHEAADQKRFSALLS
Gene ID - Mouse ENSMUSG00000026483
Gene ID - Rat ENSRNOG00000002403
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM129A pAb (ATL-HPA028172)
Datasheet Anti FAM129A pAb (ATL-HPA028172) Datasheet (External Link)
Vendor Page Anti FAM129A pAb (ATL-HPA028172) at Atlas Antibodies

Documents & Links for Anti FAM129A pAb (ATL-HPA028172)
Datasheet Anti FAM129A pAb (ATL-HPA028172) Datasheet (External Link)
Vendor Page Anti FAM129A pAb (ATL-HPA028172)