Anti FAM120B pAb (ATL-HPA037518)

Atlas Antibodies

SKU: ATL-HPA037518-25

• 

Protein Description: family with sequence similarity 120B
Gene Name: FAM120B
Alternative Gene Name: CCPG, KIAA1838, PGCC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014763: 80%, ENSRNOG00000058790: 83%
Entrez Gene ID: 84498
Uniprot ID: Q96EK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTEILKVARTHHVQAESYLVYNIMSSGEIECSNTLEDELDQALPSQAFIYRPIRQRVYSLLLEDCQDVTSTCLAVKEWFVYPGNPL
• Gene Sequence: DTEILKVARTHHVQAESYLVYNIMSSGEIECSNTLEDELDQALPSQAFIYRPIRQRVYSLLLEDCQDVTSTCLAVKEWFVYPGNPL
• Gene ID - Mouse: ENSMUSG00000014763
• Gene ID - Rat: ENSRNOG00000058790
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.