Anti FAM120B pAb (ATL-HPA037518)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037518-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FAM120B
Alternative Gene Name: CCPG, KIAA1838, PGCC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014763: 80%, ENSRNOG00000058790: 83%
Entrez Gene ID: 84498
Uniprot ID: Q96EK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DTEILKVARTHHVQAESYLVYNIMSSGEIECSNTLEDELDQALPSQAFIYRPIRQRVYSLLLEDCQDVTSTCLAVKEWFVYPGNPL |
| Gene Sequence | DTEILKVARTHHVQAESYLVYNIMSSGEIECSNTLEDELDQALPSQAFIYRPIRQRVYSLLLEDCQDVTSTCLAVKEWFVYPGNPL |
| Gene ID - Mouse | ENSMUSG00000014763 |
| Gene ID - Rat | ENSRNOG00000058790 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM120B pAb (ATL-HPA037518) | |
| Datasheet | Anti FAM120B pAb (ATL-HPA037518) Datasheet (External Link) |
| Vendor Page | Anti FAM120B pAb (ATL-HPA037518) at Atlas Antibodies |
| Documents & Links for Anti FAM120B pAb (ATL-HPA037518) | |
| Datasheet | Anti FAM120B pAb (ATL-HPA037518) Datasheet (External Link) |
| Vendor Page | Anti FAM120B pAb (ATL-HPA037518) |