Anti FAM120B pAb (ATL-HPA037518)

Atlas Antibodies

Catalog No.:
ATL-HPA037518-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 120B
Gene Name: FAM120B
Alternative Gene Name: CCPG, KIAA1838, PGCC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014763: 80%, ENSRNOG00000058790: 83%
Entrez Gene ID: 84498
Uniprot ID: Q96EK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DTEILKVARTHHVQAESYLVYNIMSSGEIECSNTLEDELDQALPSQAFIYRPIRQRVYSLLLEDCQDVTSTCLAVKEWFVYPGNPL
Gene Sequence DTEILKVARTHHVQAESYLVYNIMSSGEIECSNTLEDELDQALPSQAFIYRPIRQRVYSLLLEDCQDVTSTCLAVKEWFVYPGNPL
Gene ID - Mouse ENSMUSG00000014763
Gene ID - Rat ENSRNOG00000058790
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM120B pAb (ATL-HPA037518)
Datasheet Anti FAM120B pAb (ATL-HPA037518) Datasheet (External Link)
Vendor Page Anti FAM120B pAb (ATL-HPA037518) at Atlas Antibodies

Documents & Links for Anti FAM120B pAb (ATL-HPA037518)
Datasheet Anti FAM120B pAb (ATL-HPA037518) Datasheet (External Link)
Vendor Page Anti FAM120B pAb (ATL-HPA037518)