Anti FAM120AOS pAb (ATL-HPA021475)

Atlas Antibodies

SKU: ATL-HPA021475-25

• 

Protein Description: family with sequence similarity 120A opposite strand
Gene Name: FAM120AOS
Alternative Gene Name: C9orf10OS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030592: 25%, ENSRNOG00000039057: 26%
Entrez Gene ID: 158293
Uniprot ID: Q5T036
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSSMLPPKQALASAARNLCRGAGCNRQAVAGQLLPSTWSLHAHGLAKEAPILPVKKISRSCSVNNKVSKKTTKPPTLRSFLSP
• Gene Sequence: KSSMLPPKQALASAARNLCRGAGCNRQAVAGQLLPSTWSLHAHGLAKEAPILPVKKISRSCSVNNKVSKKTTKPPTLRSFLSP
• Gene ID - Mouse: ENSMUSG00000030592
• Gene ID - Rat: ENSRNOG00000039057
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.