Anti FAM120A pAb (ATL-HPA055800)

Atlas Antibodies

SKU:
ATL-HPA055800-25
  • Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 120A
Gene Name: FAM120A
Alternative Gene Name: C9orf10, DNAPTP1, KIAA0183, OSSA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038014: 96%, ENSRNOG00000016779: 90%
Entrez Gene ID: 23196
Uniprot ID: Q9NZB2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FYPASAYPRHFGPVPPSQGRGRGFAGVCGFGGPYGETVATGPYRAFRVAAASGHCGAFSGSDSSRTSKSQGGVQPIP
Gene Sequence FYPASAYPRHFGPVPPSQGRGRGFAGVCGFGGPYGETVATGPYRAFRVAAASGHCGAFSGSDSSRTSKSQGGVQPIP
Gene ID - Mouse ENSMUSG00000038014
Gene ID - Rat ENSRNOG00000016779
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM120A pAb (ATL-HPA055800)
Datasheet Anti FAM120A pAb (ATL-HPA055800) Datasheet (External Link)
Vendor Page Anti FAM120A pAb (ATL-HPA055800) at Atlas Antibodies

Documents & Links for Anti FAM120A pAb (ATL-HPA055800)
Datasheet Anti FAM120A pAb (ATL-HPA055800) Datasheet (External Link)
Vendor Page Anti FAM120A pAb (ATL-HPA055800)