Anti FAM117B pAb (ATL-HPA003229)

Atlas Antibodies

SKU: ATL-HPA003229-25

• 
• 

Protein Description: family with sequence similarity 117, member B
Gene Name: FAM117B
Alternative Gene Name: ALS2CR13, FLJ38771
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041040: 94%, ENSRNOG00000022066: 94%
Entrez Gene ID: 150864
Uniprot ID: Q6P1L5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ECSPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLVSILKPLLPTPDLTLKGSGHSLTVTTGMTTTLLQPIAVASLSTNTEQDRVSRGTSTVMPSASLLPPPEPIEEAE
• Gene Sequence: ECSPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLVSILKPLLPTPDLTLKGSGHSLTVTTGMTTTLLQPIAVASLSTNTEQDRVSRGTSTVMPSASLLPPPEPIEEAE
• Gene ID - Mouse: ENSMUSG00000041040
• Gene ID - Rat: ENSRNOG00000022066
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAM117B pAb (ATL-HPA003229) – 2 Found

Asplund, A; Gry Björklund, M; Sundquist, C; Strömberg, S; Edlund, K; Ostman, A; Nilsson, P; Pontén, F; Lundeberg, J. Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma. The British Journal Of Dermatology. 2008;158(3):527-38. 

Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22.