Anti FAM117A pAb (ATL-HPA022531)

Atlas Antibodies

Catalog No.: ATL-HPA022531-25

Protein Description: family with sequence similarity 117, member A
Gene Name: FAM117A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038893: 85%, ENSRNOG00000004417: 86%
Entrez Gene ID: 81558
Uniprot ID: Q9C073
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEISKLKQQLQRTKLSRSGKEKERGSPLLGDHAVRGALRASPPSFPSGSPVLRLSPCLHRSLEGLNQELEEVFVKEQGEEELLRILDIPDG
• Gene Sequence: KEISKLKQQLQRTKLSRSGKEKERGSPLLGDHAVRGALRASPPSFPSGSPVLRLSPCLHRSLEGLNQELEEVFVKEQGEEELLRILDIPDG
• Gene ID - Mouse: ENSMUSG00000038893
• Gene ID - Rat: ENSRNOG00000004417
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.