Anti FAM117A pAb (ATL-HPA022531)

Atlas Antibodies

Catalog No.:
ATL-HPA022531-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 117, member A
Gene Name: FAM117A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038893: 85%, ENSRNOG00000004417: 86%
Entrez Gene ID: 81558
Uniprot ID: Q9C073
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEISKLKQQLQRTKLSRSGKEKERGSPLLGDHAVRGALRASPPSFPSGSPVLRLSPCLHRSLEGLNQELEEVFVKEQGEEELLRILDIPDG
Gene Sequence KEISKLKQQLQRTKLSRSGKEKERGSPLLGDHAVRGALRASPPSFPSGSPVLRLSPCLHRSLEGLNQELEEVFVKEQGEEELLRILDIPDG
Gene ID - Mouse ENSMUSG00000038893
Gene ID - Rat ENSRNOG00000004417
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM117A pAb (ATL-HPA022531)
Datasheet Anti FAM117A pAb (ATL-HPA022531) Datasheet (External Link)
Vendor Page Anti FAM117A pAb (ATL-HPA022531) at Atlas Antibodies

Documents & Links for Anti FAM117A pAb (ATL-HPA022531)
Datasheet Anti FAM117A pAb (ATL-HPA022531) Datasheet (External Link)
Vendor Page Anti FAM117A pAb (ATL-HPA022531)