Anti FAM111A pAb (ATL-HPA039529)

Atlas Antibodies

SKU:
ATL-HPA039529-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 111, member A
Gene Name: FAM111A
Alternative Gene Name: FLJ22794, KIAA1895
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024691: 45%, ENSRNOG00000012067: 47%
Entrez Gene ID: 63901
Uniprot ID: Q96PZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSRKHSVNEKCNMKIEHYFSPVSKEQQNNCSTSLMRMESRGDPRATTNTQAQRFHSPKKNPEDQTMPQNRTIYVTLKVNHRRNQDMKL
Gene Sequence RSRKHSVNEKCNMKIEHYFSPVSKEQQNNCSTSLMRMESRGDPRATTNTQAQRFHSPKKNPEDQTMPQNRTIYVTLKVNHRRNQDMKL
Gene ID - Mouse ENSMUSG00000024691
Gene ID - Rat ENSRNOG00000012067
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM111A pAb (ATL-HPA039529)
Datasheet Anti FAM111A pAb (ATL-HPA039529) Datasheet (External Link)
Vendor Page Anti FAM111A pAb (ATL-HPA039529) at Atlas Antibodies

Documents & Links for Anti FAM111A pAb (ATL-HPA039529)
Datasheet Anti FAM111A pAb (ATL-HPA039529) Datasheet (External Link)
Vendor Page Anti FAM111A pAb (ATL-HPA039529)