Anti FAM110B pAb (ATL-HPA008318)
Atlas Antibodies
- SKU:
- ATL-HPA008318-25
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/82160/149601/atl-hpa008318_anti-fam110b-pab-atl-hpa008318_31230__06928.1681099048.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FAM110B
Alternative Gene Name: C8orf72, MGC39325
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049119: 96%, ENSRNOG00000009114: 95%
Entrez Gene ID: 90362
Uniprot ID: Q8TC76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KVTSVKPLKAIPCSSSAPPLPPKPKIAAIASMKSPEADPVEPACGVSRRPSLQRSKSDLSDRYFRVDADVERFFNYCGLDPEELENLGMENFARANSDIISLNFRSASMISSDC |
| Gene Sequence | KVTSVKPLKAIPCSSSAPPLPPKPKIAAIASMKSPEADPVEPACGVSRRPSLQRSKSDLSDRYFRVDADVERFFNYCGLDPEELENLGMENFARANSDIISLNFRSASMISSDC |
| Gene ID - Mouse | ENSMUSG00000049119 |
| Gene ID - Rat | ENSRNOG00000009114 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM110B pAb (ATL-HPA008318) | |
| Datasheet | Anti FAM110B pAb (ATL-HPA008318) Datasheet (External Link) |
| Vendor Page | Anti FAM110B pAb (ATL-HPA008318) at Atlas Antibodies |
| Documents & Links for Anti FAM110B pAb (ATL-HPA008318) | |
| Datasheet | Anti FAM110B pAb (ATL-HPA008318) Datasheet (External Link) |
| Vendor Page | Anti FAM110B pAb (ATL-HPA008318) |
| Citations for Anti FAM110B pAb (ATL-HPA008318) – 1 Found |
| Xie, Menghua; Cai, Lin; Li, Jingduo; Zhao, Jing; Guo, Yingxue; Hou, Zaiyu; Zhang, Xiupeng; Tian, Hua; Li, Ailin; Miao, Yuan. FAM110B Inhibits Non-Small Cell Lung Cancer Cell Proliferation and Invasion Through Inactivating Wnt/β-Catenin Signaling. Oncotargets And Therapy. 13( 32547070):4373-4384. PubMed |