Anti FAM110A pAb (ATL-HPA069240)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069240-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FAM110A
Alternative Gene Name: bA371L19.3, C20orf55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027459: 84%, ENSRNOG00000050946: 84%
Entrez Gene ID: 83541
Uniprot ID: Q9BQ89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MPVHTLSPGAPSAPALPCRLRTRVPGYLLRGPADGGARKPSAVE |
| Gene Sequence | MPVHTLSPGAPSAPALPCRLRTRVPGYLLRGPADGGARKPSAVE |
| Gene ID - Mouse | ENSMUSG00000027459 |
| Gene ID - Rat | ENSRNOG00000050946 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM110A pAb (ATL-HPA069240) | |
| Datasheet | Anti FAM110A pAb (ATL-HPA069240) Datasheet (External Link) |
| Vendor Page | Anti FAM110A pAb (ATL-HPA069240) at Atlas Antibodies |
| Documents & Links for Anti FAM110A pAb (ATL-HPA069240) | |
| Datasheet | Anti FAM110A pAb (ATL-HPA069240) Datasheet (External Link) |
| Vendor Page | Anti FAM110A pAb (ATL-HPA069240) |