Anti FAM107B pAb (ATL-HPA073195)

Atlas Antibodies

Catalog No.:
ATL-HPA073195-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 107 member B
Gene Name: FAM107B
Alternative Gene Name: C10orf45, FLJ45505, HITS, MGC11034
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026655: 99%, ENSRNOG00000014886: 99%
Entrez Gene ID: 83641
Uniprot ID: Q9H098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHRELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQ
Gene Sequence LHRELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQ
Gene ID - Mouse ENSMUSG00000026655
Gene ID - Rat ENSRNOG00000014886
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM107B pAb (ATL-HPA073195)
Datasheet Anti FAM107B pAb (ATL-HPA073195) Datasheet (External Link)
Vendor Page Anti FAM107B pAb (ATL-HPA073195) at Atlas Antibodies

Documents & Links for Anti FAM107B pAb (ATL-HPA073195)
Datasheet Anti FAM107B pAb (ATL-HPA073195) Datasheet (External Link)
Vendor Page Anti FAM107B pAb (ATL-HPA073195)