Anti FAM107B pAb (ATL-HPA058814)

Atlas Antibodies

SKU:
ATL-HPA058814-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 107, member B
Gene Name: FAM107B
Alternative Gene Name: C10orf45, FLJ45505, MGC11034
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028919: 27%, ENSRNOG00000011504: 28%
Entrez Gene ID: 83641
Uniprot ID: Q9H098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASFNQSGVADTHSTVRVQPVAKAGRQPRHPSAEGAPEKRQDSSTHAERNGSANRNSSHRTAAQPAETPEDVPGSLDDG
Gene Sequence ASFNQSGVADTHSTVRVQPVAKAGRQPRHPSAEGAPEKRQDSSTHAERNGSANRNSSHRTAAQPAETPEDVPGSLDDG
Gene ID - Mouse ENSMUSG00000028919
Gene ID - Rat ENSRNOG00000011504
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM107B pAb (ATL-HPA058814)
Datasheet Anti FAM107B pAb (ATL-HPA058814) Datasheet (External Link)
Vendor Page Anti FAM107B pAb (ATL-HPA058814) at Atlas Antibodies

Documents & Links for Anti FAM107B pAb (ATL-HPA058814)
Datasheet Anti FAM107B pAb (ATL-HPA058814) Datasheet (External Link)
Vendor Page Anti FAM107B pAb (ATL-HPA058814)