Anti FAM107B pAb (ATL-HPA039661)

Atlas Antibodies

SKU:
ATL-HPA039661-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line Daudi
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 107, member B
Gene Name: FAM107B
Alternative Gene Name: C10orf45, FLJ45505, MGC11034
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026655: 50%, ENSRNOG00000014886: 49%
Entrez Gene ID: 83641
Uniprot ID: Q9H098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FHASIPRPSIIDTPKEEEFREEPKCLELEQKMTSDSPPEDIDHKDSYLITRSIMAEPDYIEDDNPELIRPQKLINPVK
Gene Sequence FHASIPRPSIIDTPKEEEFREEPKCLELEQKMTSDSPPEDIDHKDSYLITRSIMAEPDYIEDDNPELIRPQKLINPVK
Gene ID - Mouse ENSMUSG00000026655
Gene ID - Rat ENSRNOG00000014886
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM107B pAb (ATL-HPA039661)
Datasheet Anti FAM107B pAb (ATL-HPA039661) Datasheet (External Link)
Vendor Page Anti FAM107B pAb (ATL-HPA039661) at Atlas Antibodies

Documents & Links for Anti FAM107B pAb (ATL-HPA039661)
Datasheet Anti FAM107B pAb (ATL-HPA039661) Datasheet (External Link)
Vendor Page Anti FAM107B pAb (ATL-HPA039661)



Citations for Anti FAM107B pAb (ATL-HPA039661) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed