Anti FAM107A pAb (ATL-HPA055888 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA055888-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 107, member A
Gene Name: FAM107A
Alternative Gene Name: DRR1, TU3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021750: 88%, ENSRNOG00000033261: 91%
Entrez Gene ID: 11170
Uniprot ID: O95990
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEER
Gene Sequence NQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEER
Gene ID - Mouse ENSMUSG00000021750
Gene ID - Rat ENSRNOG00000033261
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM107A pAb (ATL-HPA055888 w/enhanced validation)
Datasheet Anti FAM107A pAb (ATL-HPA055888 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM107A pAb (ATL-HPA055888 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FAM107A pAb (ATL-HPA055888 w/enhanced validation)
Datasheet Anti FAM107A pAb (ATL-HPA055888 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM107A pAb (ATL-HPA055888 w/enhanced validation)
Citations for Anti FAM107A pAb (ATL-HPA055888 w/enhanced validation) – 3 Found
Xiang, Yangfei; Tanaka, Yoshiaki; Patterson, Benjamin; Hwang, Sung-Min; Hysolli, Eriona; Cakir, Bilal; Kim, Kun-Yong; Wang, Wanshan; Kang, Young-Jin; Clement, Ethan M; Zhong, Mei; Lee, Sang-Hun; Cho, Yee Sook; Patra, Prabir; Sullivan, Gareth J; Weissman, Sherman M; Park, In-Hyun. Dysregulation of BRD4 Function Underlies the Functional Abnormalities of MeCP2 Mutant Neurons. Molecular Cell. 2020;79(1):84-98.e9.  PubMed
Jabali, Ammar; Hoffrichter, Anne; Uzquiano, Ana; Marsoner, Fabio; Wilkens, Ruven; Siekmann, Marco; Bohl, Bettina; Rossetti, Andrea C; Horschitz, Sandra; Koch, Philipp; Francis, Fiona; Ladewig, Julia. Human cerebral organoids reveal progenitor pathology in EML1-linked cortical malformation. Embo Reports. 2022;23(5):e54027.  PubMed
Zhou, Xin; Zhong, Suijuan; Peng, Honghai; Liu, Jing; Ding, Wenyu; Sun, Le; Ma, Qiang; Liu, Zeyuan; Chen, Ruiguo; Wu, Qian; Wang, Xiaoqun. Cellular and molecular properties of neural progenitors in the developing mammalian hypothalamus. Nature Communications. 2020;11(1):4063.  PubMed