Anti FAF2 pAb (ATL-HPA065968)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065968-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FAF2
Alternative Gene Name: ETEA, KIAA0887, UBXD8, UBXN3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025873: 99%, ENSRNOG00000017607: 98%
Entrez Gene ID: 23197
Uniprot ID: Q96CS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PEPSPDDPESVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEWPNPPTLQEAGLSHTEV |
| Gene Sequence | PEPSPDDPESVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEWPNPPTLQEAGLSHTEV |
| Gene ID - Mouse | ENSMUSG00000025873 |
| Gene ID - Rat | ENSRNOG00000017607 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAF2 pAb (ATL-HPA065968) | |
| Datasheet | Anti FAF2 pAb (ATL-HPA065968) Datasheet (External Link) |
| Vendor Page | Anti FAF2 pAb (ATL-HPA065968) at Atlas Antibodies |
| Documents & Links for Anti FAF2 pAb (ATL-HPA065968) | |
| Datasheet | Anti FAF2 pAb (ATL-HPA065968) Datasheet (External Link) |
| Vendor Page | Anti FAF2 pAb (ATL-HPA065968) |