Anti FAF2 pAb (ATL-HPA065968)

Atlas Antibodies

SKU: ATL-HPA065968-25

• 
• 

Protein Description: Fas associated factor family member 2
Gene Name: FAF2
Alternative Gene Name: ETEA, KIAA0887, UBXD8, UBXN3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025873: 99%, ENSRNOG00000017607: 98%
Entrez Gene ID: 23197
Uniprot ID: Q96CS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PEPSPDDPESVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEWPNPPTLQEAGLSHTEV
• Gene Sequence: PEPSPDDPESVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEWPNPPTLQEAGLSHTEV
• Gene ID - Mouse: ENSMUSG00000025873
• Gene ID - Rat: ENSRNOG00000017607
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.