Anti FADS6 pAb (ATL-HPA016802)

Atlas Antibodies

SKU:
ATL-HPA016802-25
  • Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in subset of glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: fatty acid desaturase 6
Gene Name: FADS6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044788: 87%, ENSRNOG00000021380: 86%
Entrez Gene ID: 283985
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GHSIISCHVEHHLFPRLSDNMCLKVKPVVSQFLREKQLPYNEDSYLARFQLFLRRYEEFMVQAPPITELV
Gene Sequence GHSIISCHVEHHLFPRLSDNMCLKVKPVVSQFLREKQLPYNEDSYLARFQLFLRRYEEFMVQAPPITELV
Gene ID - Mouse ENSMUSG00000044788
Gene ID - Rat ENSRNOG00000021380
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FADS6 pAb (ATL-HPA016802)
Datasheet Anti FADS6 pAb (ATL-HPA016802) Datasheet (External Link)
Vendor Page Anti FADS6 pAb (ATL-HPA016802) at Atlas Antibodies

Documents & Links for Anti FADS6 pAb (ATL-HPA016802)
Datasheet Anti FADS6 pAb (ATL-HPA016802) Datasheet (External Link)
Vendor Page Anti FADS6 pAb (ATL-HPA016802)