Anti FADS3 pAb (ATL-HPA045224)

Atlas Antibodies

Catalog No.: ATL-HPA045224-25

Protein Description: fatty acid desaturase 3
Gene Name: FADS3
Alternative Gene Name: CYB5RP, LLCDL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024664: 92%, ENSRNOG00000020385: 90%
Entrez Gene ID: 3995
Uniprot ID: Q9Y5Q0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAED
• Gene Sequence: PLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAED
• Gene ID - Mouse: ENSMUSG00000024664
• Gene ID - Rat: ENSRNOG00000020385
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.