Anti FADS3 pAb (ATL-HPA045224)

Atlas Antibodies

Catalog No.:
ATL-HPA045224-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: fatty acid desaturase 3
Gene Name: FADS3
Alternative Gene Name: CYB5RP, LLCDL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024664: 92%, ENSRNOG00000020385: 90%
Entrez Gene ID: 3995
Uniprot ID: Q9Y5Q0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAED
Gene Sequence PLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAED
Gene ID - Mouse ENSMUSG00000024664
Gene ID - Rat ENSRNOG00000020385
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FADS3 pAb (ATL-HPA045224)
Datasheet Anti FADS3 pAb (ATL-HPA045224) Datasheet (External Link)
Vendor Page Anti FADS3 pAb (ATL-HPA045224) at Atlas Antibodies

Documents & Links for Anti FADS3 pAb (ATL-HPA045224)
Datasheet Anti FADS3 pAb (ATL-HPA045224) Datasheet (External Link)
Vendor Page Anti FADS3 pAb (ATL-HPA045224)