Anti FA2H pAb (ATL-HPA056614)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056614-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FA2H
Alternative Gene Name: FAAH, FAXDC1, FLJ25287, SPG35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033579: 92%, ENSRNOG00000018950: 95%
Entrez Gene ID: 79152
Uniprot ID: Q7L5A8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGS |
| Gene Sequence | LIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGS |
| Gene ID - Mouse | ENSMUSG00000033579 |
| Gene ID - Rat | ENSRNOG00000018950 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FA2H pAb (ATL-HPA056614) | |
| Datasheet | Anti FA2H pAb (ATL-HPA056614) Datasheet (External Link) |
| Vendor Page | Anti FA2H pAb (ATL-HPA056614) at Atlas Antibodies |
| Documents & Links for Anti FA2H pAb (ATL-HPA056614) | |
| Datasheet | Anti FA2H pAb (ATL-HPA056614) Datasheet (External Link) |
| Vendor Page | Anti FA2H pAb (ATL-HPA056614) |